PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020888m
Common NameCARUB_v10020888mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 234aa    MW: 26625.8 Da    PI: 7.4521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020888mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.4e-141257348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+ Ed ll +++ ++G g W++++ + g++R+ k+c++rw++yl
  Carubv10020888m 12 AWTAVEDSLLRQCIDKYGEGKWHKVPLRAGLNRSCKSCRERWLNYL 57
                     8*******************************************97 PP

2Myb_DNA-binding42.71.3e-1363108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +  +E +ll++++k+l ++ W++Ia +++ gRt++++k++w ++l
  Carubv10020888m  63 RGEFGSDEVDLLLRLHKLLRNR-WSLIAGRLP-GRTANDVKNYWKTHL 108
                      789999****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-19559IPR009057Homeodomain-like
PROSITE profilePS5129422.714561IPR017930Myb domain
SuperFamilySSF466893.48E-268104IPR009057Homeodomain-like
SMARTSM007172.2E-13959IPR001005SANT/Myb domain
PfamPF002499.0E-131157IPR001005SANT/Myb domain
CDDcd001672.11E-101257No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2060111IPR009057Homeodomain-like
PROSITE profilePS5129417.2762112IPR017930Myb domain
SMARTSM007171.0E-1262110IPR001005SANT/Myb domain
PfamPF002492.5E-1263108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEGSSEGLRK AAWTAVEDSL LRQCIDKYGE GKWHKVPLRA GLNRSCKSCR ERWLNYLNPN  60
IKRGEFGSDE VDLLLRLHKL LRNRWSLIAG RLPGRTANDV KNYWKTHLGK KQEPRFTSKT  120
RKRDVACSAA SQAQELSVTK HQTQSYNGRS QLNGQTEVGL FQVSNNDEEQ SQLLNSQIDG  180
ESMWWKSLLE QNQEAYTDGP VAITDDEADI TSMESMSSLF DVQKLWILFN EGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1981115107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302766.11e-174hypothetical protein CARUB_v10020888mg
SwissprotQ9FE252e-75MYB75_ARATH; Transcription factor MYB75
TrEMBLR0I0F51e-174R0I0F5_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_20009501e-105(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.14e-75production of anthocyanin pigment 1